Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: I3LCH3
RecName: Uncharacterized protein
Begin-End: 20-256
Organism: Sus scrofa
Interaction Mode:   

Sequence:
KFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIV
DKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDP
SDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPK
PEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKL
Structures of the domain I3LCH3 20-256
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 C 20-256 None
6gmh X-ray 3.1 C 20-256 None
6exv X-ray 3.6 C 20-256 None
6ted X-ray 3.1 C 20-256 None


© NPIDB team 2003 - 2021

text