Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.16)
Uniprot AC: I3LGP4
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 278-471
Organism: Sus scrofa
Interaction Mode:   

Sequence:
ATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATL
PYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRR
ELDDRDHYGNKRLD
Structures of the domain I3LGP4 278-471
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 B 201-394 None
6gmh X-ray 3.1 B 201-394 None
6exv X-ray 3.6 B 201-394 None
6ted X-ray 3.1 B 201-394 None


© NPIDB team 2003 - 2021

text