Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: I3LGP4
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 545-609
Organism: Sus scrofa
Interaction Mode:   

Sequence:
QVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLA
LMAYI
Structures of the domain I3LGP4 545-609
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 B 468-532  L-Bb 
6gmh X-ray 3.1 B 468-532 None
6exv X-ray 3.6 B 468-532 None
6ted X-ray 3.1 B 468-532 None


© NPIDB team 2003 - 2021

text