Pfam domain
Pfam family: RNA_pol_Rpb2_4 (PF04566.15)
Uniprot AC: I3LGP4
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 644-706
Organism: Sus scrofa
Interaction Mode:   

Sequence:
IFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLL
IVE
Structures of the domain I3LGP4 644-706
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 B 567-629 None
6gmh X-ray 3.1 B 567-629 None
6exv X-ray 3.6 B 567-629 None
6ted X-ray 3.1 B 567-629 None


© NPIDB team 2003 - 2021

text