Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.30)
Uniprot AC: I3LGP4
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 784-1157
Organism: Sus scrofa
Interaction Mode:   

Sequence:
CASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEY
LRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQE
EVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRR
YTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCG
IQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAV
NVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGP
IQILNRQPMEGRSR
Structures of the domain I3LGP4 784-1157
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 B 707-1080 None
6gmh X-ray 3.1 B 707-1080  L-Bb 
6exv X-ray 3.6 B 707-1080 None
6ted X-ray 3.1 B 707-1080  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text