Pfam domain
Pfam family: RNA_pol_Rpb1_7 (PF04990.14)
Uniprot AC: I3LJR4
RecName: DNA-directed RNA polymerase subunit
Begin-End: 1145-1279
Organism: Sus scrofa
Interaction Mode:   

Sequence:
RDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARIS
PWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENK
MQEEEEVVDKMDDDV
Structures of the domain I3LJR4 1145-1279
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 A 1164-1299 None
6gmh X-ray 3.1 A 1164-1299 None
6exv X-ray 3.6 A 1164-1299 None


© NPIDB team 2003 - 2021

text