Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: I3LJR4
RecName: DNA-directed RNA polymerase subunit
Begin-End: 15-354
Organism: Sus scrofa
Interaction Mode:   

Sequence:
LRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTC
AGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSK
GQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRS
GLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLP
VPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHV
ATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNL
Structures of the domain I3LJR4 15-354
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 A 15-354  H-Bb L-Bb 
6gmh X-ray 3.1 A 15-354  H-Bb L-Mj L-Mn 
6exv X-ray 3.6 A 15-354  H-Bb 


© NPIDB team 2003 - 2021

text