Pfam domain
Pfam family: RNA_pol_Rpb1_4 (PF05000.19)
Uniprot AC: I3LJR4
RecName: DNA-directed RNA polymerase subunit
Begin-End: 697-804
Organism: Sus scrofa
Interaction Mode:   

Sequence:
DIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSL
SEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLP
Structures of the domain I3LJR4 697-804
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 A 716-823 None
6gmh X-ray 3.1 A 716-823 None
6exv X-ray 3.6 A 716-823 None


© NPIDB team 2003 - 2021

text