Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: I3LJR4
RecName: DNA-directed RNA polymerase subunit
Begin-End: 811-1399
Organism: Sus scrofa
Interaction Mode:   

Sequence:
YGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVK
YDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTL
QEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIF
HINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRM
AEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSA
KNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTA
IYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEK
INAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLT
DMTLKVSRSLPATDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSND
IVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGH
Structures of the domain I3LJR4 811-1399
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 A 830-1425  L-Bb 
6gmh X-ray 3.1 A 830-1425  H-Mn 
6exv X-ray 3.6 A 830-1425  L-Bb 


© NPIDB team 2003 - 2021

text