Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: I3LJZ9
RecName: Uncharacterized protein
Begin-End: 78-161
Organism: Sus scrofa
Interaction Mode:   

Sequence:
RPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVI
QQDDEIRLKIVGTRVDKNDIFAIG
Structures of the domain I3LJZ9 78-161
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 G 78-161 None
6gmh X-ray 3.1 G 78-161 None
6exv X-ray 3.6 G 78-161 None
6ted X-ray 3.1 G 78-161 None


© NPIDB team 2003 - 2021

text