Pfam domain
Pfam family: SHS2_Rpb7-N (PF03876.19)
Uniprot AC: I3LJZ9
RecName: Uncharacterized protein
Begin-End: 8-64
Organism: Sus scrofa
Interaction Mode:   

Sequence:
EHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRG
Structures of the domain I3LJZ9 8-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 G 8-64 None
6gmh X-ray 3.1 G 8-64 None
6exv X-ray 3.6 G 8-64 None
6ted X-ray 3.1 G 8-64 None


© NPIDB team 2003 - 2021

text