Pfam domain
Pfam family: RNA_pol_Rpb5_C (PF01191.21)
Uniprot AC: I3LSI7
RecName: Uncharacterized protein
Begin-End: 137-209
Organism: Sus scrofa
Interaction Mode:   

Sequence:
INITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRP
SETAGRYITYRLV
Structures of the domain I3LSI7 137-209
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 E 137-209 None
6gmh X-ray 3.1 E 137-209 None
6exv X-ray 3.6 E 137-209 None
6ted X-ray 3.1 E 137-209 None


© NPIDB team 2003 - 2021

text