Pfam domain
Pfam family: RNA_pol_Rpb5_N (PF03871.16)
Uniprot AC: I3LSI7
RecName: Uncharacterized protein
Begin-End: 4-94
Organism: Sus scrofa
Interaction Mode:   

Sequence:
EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVA
HNDDPTDQMFVFFPEEPKVGIKTIKVYCQRM
Structures of the domain I3LSI7 4-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 E 4-94 None
6gmh X-ray 3.1 E 4-94  H-Bb L-Bb 
6exv X-ray 3.6 E 4-94 None
6ted X-ray 3.1 E 4-94  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text