Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: I4E596
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 135-219
Organism: Neisseria meningitidis alpha522
Interaction Mode:  H-Bb L-Bb 

Sequence:
LGPEPLSEAFCADYLYARLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPAN
RLKKKECALLVETVKAVLQRAIETG
Structures of the domain I4E596 135-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tc9 X-ray 2.18 C 135-239  H-Bb L-Bb 
6tc9 X-ray 2.18 A 135-240  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text