Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.26)
Uniprot AC: I4E596
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 2-119
Organism: Neisseria meningitidis alpha522
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
PELPEVETTLRGIAPHIEGKTVEAVVLRQLKLRWQINPDLGEILSGRQVLSCGRRAKYLL
IRFQTGVLLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAI
Structures of the domain I4E596 2-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tc9 X-ray 2.18 C 2-119  S-Bb L-Bb L-Mj L-Mn 
6tc9 X-ray 2.18 A 2-119  S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text