Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: I6L991
RecName: Uncharacterized protein
Begin-End: 26-127
Organism: Mus musculus
Interaction Mode:   

Sequence:
QTTSSLSASLGDRVTISCSASQGISNYLNWYQQKPDGTVKLLIYYTSSLHSGVPSRFSGS
GSGTHYSLTISNLEPEDIATYYCQQYSQFPFTFGSGTKLEIK
Structures of the domain I6L991 26-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1n6q X-ray 3 L 6-107 None


© NPIDB team 2003 - 2021

text