Pfam domain
Pfam family: CRISPR_Cas9_WED (PF18061.3)
Uniprot AC: J7RUA5
RecName: CRISPR-associated endonuclease Cas9
Begin-End: 781-907
Organism: Staphylococcus aureus
Interaction Mode:  S-Bb S-Mn L-Bb 

Sequence:
RELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKL
KLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNS
RNKVVKL
Structures of the domain J7RUA5 781-907
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5czz X-ray 2.6 A 781-907  S-Bb S-Mn L-Bb 
5axw X-ray 2.7 A 781-907  S-Bb L-Bb 


© NPIDB team 2003 - 2021

text