Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: L3PZ69
RecName: 30S ribosomal protein S4
Begin-End: 96-143
Organism: Escherichia coli KTE75
Interaction Mode:   

Sequence:
GRLDNVVYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVV
Structures of the domain L3PZ69 96-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o7k X-ray 4.2 l 95-142 None


© NPIDB team 2003 - 2021

text