Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: L4IY67
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-60
Organism: Escherichia coli KTE146
Interaction Mode:   

Sequence:
DAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
Structures of the domain L4IY67 8-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rh3 X-ray 3.6 E 8-60 None


© NPIDB team 2003 - 2021

text