Pfam domain
Pfam family: Phage_antitermQ (PF06530.14)
Uniprot AC: M1FPN0
RecName: Antiterminator Q protein
Begin-End: 13-125
Organism: Enterobacteria phage SfI
Interaction Mode:   

Sequence:
HEWLNGWLELWGAWVYSGRLEKRMSSVIAKFMESVEPGRVMTRPMCNDDDGMLISQVVDS
VMYIDKKAFGILLSYYAHGSSKHAIASYYHRVARPRKMLCRGGGRIQKPSLAT
Structures of the domain M1FPN0 13-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6jnx X-ray 4.08 Q 15-103  H-Bb H-Mj L-Bb 
6jnx X-ray 4.08 P 15-103  H-Bb 


© NPIDB team 2003 - 2021

text