Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: O00327
RecName: Aryl hydrocarbon receptor nuclear translocator-like protein 1
Begin-End: 73-126
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
AREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLR
Structures of the domain O00327 73-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4h10 X-ray 2.4 A 73-126  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text