Pfam domain
Pfam family: Forkhead (PF00250.20)
Uniprot AC: O00409
RecName: Forkhead box protein N3
Begin-End: 113-200
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
CKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCF
KKVDKERSQSIGKGSLWCIDPEYRQNLI
Structures of the domain O00409 113-200
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ncm X-ray 2.7 A 113-200  H-Bb H-Mj S-Bb L-Bb 
6ncm X-ray 2.7 B 113-200  H-Bb H-Mj L-Bb 
6nce X-ray 2.6 A 113-200  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text