Pfam domain
Pfam family: Homeobox_KN (PF05920.13)
Uniprot AC: O00470
RecName: Homeobox protein Meis1
Begin-End: 290-329
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj 

Sequence:
WLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR
Structures of the domain O00470 290-329
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ego X-ray 2.54 A 290-329  H-Bb H-Mj 
4xrs X-ray 3.5 A 290-329 None
4xrs X-ray 3.5 B 290-329 None


© NPIDB team 2003 - 2021

text