Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: O00571
RecName: ATP-dependent RNA helicase DDX3X
Begin-End: 204-392
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRR
KQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT
PGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSA
TFPKEIQML
Structures of the domain O00571 204-392
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o5f X-ray 2.5 B 204-392 None
6o5f X-ray 2.5 A 204-392 None


© NPIDB team 2003 - 2021

text