Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: O01378
RecName: BmVLG protein
Begin-End: 204-383
Organism: Bombyx mori
Interaction Mode:   

Sequence:
TPIQKNAIPIIMSGRDLMGCAQTGSGKTAAFLVPIINMLLQDPKDLISENGCAQPQVIIV
SPTRELTLQIFNEARKFSYGSVLKVAVAYGGTAVRHQGDNIARGCHILVATPGRLHDFVE
RNRVSFGSVRFVVLDEADRMLDMGFMPSIEKMMLHPTMVETTKRQTLMFSATFPEDIQHL
Structures of the domain O01378 204-383
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d26 X-ray 2.1 A 204-383 None
4d25 X-ray 1.9 A 204-383 None


© NPIDB team 2003 - 2021

text