Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: O05858
RecName: Probable transcriptional regulatory protein (Probably TetR-family)
Begin-End: 44-90
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
LLVVASDVFVDRGYHAAGMDEIADRAGVSKPVLYQHFSSKLELYLAV
Structures of the domain O05858 44-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o6p X-ray 3.85 A 44-90  H-Bb H-Mj L-Bb 
6o6p X-ray 3.85 B 44-90  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text