Pfam domain
Pfam family: SRP54_N (PF02881.21)
Uniprot AC: O07347
RecName: Signal recognition particle protein
Begin-End: 5-82
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
LSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQV
LESLTPAEVILATVYEAL
Structures of the domain O07347 5-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2iy3 X-ray 16 A 5-82 None
2xkv X-ray 13.5 A 5-82 None
1ry1 X-ray 12 U 5-82 None
3zn8 X-ray 12 A 5-82 None


© NPIDB team 2003 - 2021

text