Pfam domain
Pfam family: RAG1 (PF12940.9)
Uniprot AC: O13033
RecName: V(D)J recombination-activating protein 1
Begin-End: 408-1029
Organism: Danio rerio
Interaction Mode:   

Sequence:
GGRPRQHLLSLTRRAQKHRLRDLKNQVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQA
DELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTLRNAEK
ELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALK
DLEEDIMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIM
SISIRLEGEDDGITIFQEQKPNSELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMES
RLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLCDSTRAEASQNMVLHS
ITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFY
KIFQDEIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEA
VCELVPSEERREALLKLMDLYLQMKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFK
YRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRRFRKMNARQSKTFELE
DILKHHWLYTSKYLQKFMEAHK
Structures of the domain O13033 408-1029
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dbx X-ray 4.2 C 408-1030  H-Bb H-Mj H-Mn L-Bb L-Mn 
6dbx X-ray 4.2 A 408-1028  H-Bb L-Bb L-Mn 
3jbw X-ray 4.63 C 408-1029  H-Bb H-Mj H-Mn L-Mj 
3jbw X-ray 4.63 A 408-1029  H-Bb H-Mj L-Mj 
6dbq X-ray 4.22 A 408-1028  H-Bb H-Mj L-Mn 
6dbq X-ray 4.22 C 408-1029  H-Bb H-Mj L-Bb L-Mn 
6dbi X-ray 3.36 A 408-1029  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6dbi X-ray 3.36 C 408-1029  H-Bb H-Mj L-Bb L-Mj L-Mn 
6dbl X-ray 5 C 408-1029  H-Mj L-Bb L-Mn 
6dbl X-ray 5 A 408-1029  H-Bb H-Mj L-Bb L-Mj L-Mn 
6dbt X-ray 4.3 C 408-1028  H-Bb H-Mj L-Mn 
6dbt X-ray 4.3 A 408-1028  H-Bb H-Mj L-Bb L-Mn 
6dbw X-ray 4.7 C 408-1030  H-Bb H-Mj L-Bb L-Mn 
6dbw X-ray 4.7 A 408-1029  H-Bb S-Bb L-Bb L-Mj L-Mn 
6dbv X-ray 4.29 A 408-1029  H-Bb H-Mj L-Mj L-Mn 
6dbv X-ray 4.29 C 408-1028  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text