Pfam domain
Pfam family: NTP_transf_2 (PF01909.25)
Uniprot AC: O13833
RecName: Terminal uridylyltransferase cid1
Begin-End: 69-169
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
LDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAE
GFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAI
Structures of the domain O13833 69-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4nku X-ray 1.94 B 69-183 None


© NPIDB team 2003 - 2021

text