Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: O14467
RecName: Multiprotein-bridging factor 1
Begin-End: 85-137
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ISRARTDKKMSQKDLATKINEKPTVVNDYEAARAIPNQQVLSKLERALGVKLR
Structures of the domain O14467 85-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zvi X-ray 3 T 60-112 None


© NPIDB team 2003 - 2021

text