Pfam domain
Pfam family: Homeobox_KN (PF05920.13)
Uniprot AC: O14770
RecName: Homeobox protein Meis2
Begin-End: 294-333
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
WLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR
Structures of the domain O14770 294-333
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5eg0 X-ray 3.1 A 290-329  H-Bb H-Mj L-Bb 
4xrm X-ray 1.6 B 290-329  H-Bb H-Mj L-Bb 
4xrm X-ray 1.6 A 290-329  H-Bb H-Mj L-Bb 
5bng X-ray 3.5 A 16-55  H-Bb H-Mj L-Bb 
5bng X-ray 3.5 B 16-55  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text