Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: O15516
RecName: Circadian locomoter output cycles protein kaput
Begin-End: 35-85
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHK
Structures of the domain O15516 35-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4h10 X-ray 2.4 B 35-85  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text