Pfam domain
Pfam family: Piwi (PF02171.19)
Uniprot AC: O28951
RecName: Piwi protein AF_1318
Begin-End: 110-406
Organism: Archaeoglobus fulgidus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Mj L-Mn 

Sequence:
GIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPW
ILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKST
IKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAI
LHLNETHPFWVMGDPNNRFHPYEGTKVKLSSKRYLLTLLQPYLKRNGLEMVTPIKPLSVE
IVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNR
Structures of the domain O28951 110-406
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2w42 X-ray 1.9 A 110-406 None
2w42 X-ray 1.9 B 110-406 None
1ytu X-ray 2.5 B 110-406 None
1ytu X-ray 2.5 A 110-406 None
2bgg X-ray 2.2 B 110-406 None
2bgg X-ray 2.2 A 110-406 None
6t5t X-ray 1.7 A 110-406  H-Bb H-Mj H-Mn S-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text