Pfam domain
Pfam family: XPG_I (PF00867.20)
Uniprot AC: O29975
RecName: Flap endonuclease 1
Begin-End: 142-235
Organism: Archaeoglobus fulgidus
Interaction Mode:  L-Bb 

Sequence:
GIPFVDAPSEGEAQAAYMAAKGDVEYTGSQDYDSLLFGSPRLARNLAITGKRKLPGKNVY
VDVKPEIIILESNLKRLGLTREQLIDIAILVGTD
Structures of the domain O29975 142-235
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rxv X-ray 2.5 B 142-235 None
1rxv X-ray 2.5 A 142-235 None
1rxw X-ray 2 A 142-235  L-Bb 


© NPIDB team 2003 - 2021

text