Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: O48503
RecName: CI
Begin-End: 9-72
Organism: Lactococcus phage TP901-1
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
LKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLLAKTLGVS
EAWL
Structures of the domain O48503 9-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3zhm X-ray 2.6 A 9-72  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text