Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: O53623
RecName: Probable transcriptional regulatory protein
Begin-End: 19-65
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
LITGARKLWGLRGYAEVGTPEIATEAGVTRGAMYHQFADKAALFRDV
Structures of the domain O53623 19-65
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c31 X-ray 3 B 19-65  H-Bb H-Mj L-Bb 
6c31 X-ray 3 C 19-65  H-Bb H-Mj L-Bb L-Mj 
6c31 X-ray 3 D 19-65  H-Bb H-Mj L-Bb 
6c31 X-ray 3 A 19-65  H-Bb H-Mj L-Bb 
6c31 X-ray 3 G 19-65  H-Bb H-Mj L-Bb L-Mj 
6c31 X-ray 3 H 19-65  H-Bb H-Mj L-Bb 
6c31 X-ray 3 E 19-65  H-Bb H-Mj L-Bb 
6c31 X-ray 3 F 19-65  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text