Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: O57204
RecName: DNA-directed RNA polymerase 147 kDa polypeptide
Begin-End: 279-440
Organism: Vaccinia virus
Interaction Mode:   

Sequence:
ARRKDQTARSVIGPSTSITVNEVGMPAYIRNTLTEKIFVNAFTVDKVKQLLASNQVKFYF
NKRLNQLTRIRQGKFIKNKIHLLPGDWVEVAVQEYTSIIFGRQPSLHRYNVIASSIRATE
GDTIKISPGIVNSQNADFDGDEEWMILEQNPKAVIEQSILMY
Structures of the domain O57204 279-440
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rie X-ray 3.1 A 279-440 None


© NPIDB team 2003 - 2021

text