Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.20)
Uniprot AC: O57204
RecName: DNA-directed RNA polymerase 147 kDa polypeptide
Begin-End: 445-581
Organism: Vaccinia virus
Interaction Mode:   

Sequence:
LKHDIHGAPVYGSIQDEIVAAYSLFRIQDLCLDEVLNILGKYGREFDPKGKCKFSGKDIY
TYLIGEKINYPGLLKDGEIIANDVDSNFVVAMRHLSLAGLLSDHKSNVEGINFIIKSSYV
FKRYLSIYGFGVTFKDL
Structures of the domain O57204 445-581
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rie X-ray 3.1 A 445-581 None


© NPIDB team 2003 - 2021

text