Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: O57204
RecName: DNA-directed RNA polymerase 147 kDa polypeptide
Begin-End: 725-1212
Organism: Vaccinia virus
Interaction Mode:   

Sequence:
GLTGSQYYFSMLVARSQSTDIVCETSRTGTLARKIIKKMEDMVVDGYGQVVIGNTLIKYA
ANYTKILGSVCKPVDLIYPDESMTWYLEISALWNKIKQGFVYSQKQKLAKKTLAPFNFLV
FVKPTTEDNAIKVKDLYDMIHNVIDDVREKYFFTVSNIDFMEYIFLTHLNPSRIRITKET
AITIFEKFYEKLNYTLGGGTPIGIISAQVLSEKFTQQALSSFHTTEKSGAVKQKLGFNEF
NNLTNLSKNKTEIITLVSDDISKLQSVKINFEFVCLGELNPNITLRKETDRYVVDIIVNR
LYIKRAEITELVVEYMIERFISFSVIVKEWGMETFIEDEDNIRFTVYLNFVEPEELNLSK
FMMVLPGAANKGKISKFKIPISDYTGYDDFNQTKKLNKMTVELMNLKELGSFDLENVNVY
PGVWNTYDIFGIEAAREYLCEAMLNTYGEGFDYLYQPCDLLASLLCASYEPESVNKFKFG
AASTLKRA
Structures of the domain O57204 725-1212
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rie X-ray 3.1 A 725-1188 None


© NPIDB team 2003 - 2021

text