Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: O58655
RecName: Translation initiation factor 2 subunit alpha
Begin-End: 8-83
Organism: Pyrococcus horikoshii
Interaction Mode:   

Sequence:
YPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAK
VIRVDPRKGHIDLSLR
Structures of the domain O58655 8-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3aev X-ray 2.8 A 8-83 None


© NPIDB team 2003 - 2021

text