Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: O60231
RecName: Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
Begin-End: 402-562
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSV
AARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDE
AHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFST
Structures of the domain O60231 402-562
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ff7 X-ray 4.5 q 403-563 None
5z58 X-ray 4.9 x 402-562 None


© NPIDB team 2003 - 2021

text