Pfam domain
Pfam family: Amino_oxidase (PF01593.26)
Uniprot AC: O60341
RecName: Lysine-specific histone demethylase 1A
Begin-End: 288-826
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSK
QVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVS
LGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASE
VKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQ
ILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLN
TAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWK
TSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALV
AGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAG
SSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIA
Structures of the domain O60341 288-826
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xbf X-ray 2.8 A 288-826 None
6vyp X-ray 4.99 K 288-826 None
6vyp X-ray 4.99 M 288-826 None
6vyp X-ray 4.99 k 288-826 None
6vyp X-ray 4.99 m 288-826 None


© NPIDB team 2003 - 2021

text