Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: O60814
RecName: Histone H2B type 1-K
Begin-End: 31-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
KRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTI
TSREIQTAVRLL
Structures of the domain O60814 31-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2cv5 X-ray 2.5 H 29-97  H-Bb S-Bb L-Bb 
2cv5 X-ray 2.5 D 27-97  H-Bb H-Mj S-Bb L-Bb 
6t7b X-ray 5.1 H 27-97  S-Bb L-Bb 
6t7b X-ray 5.1 D 27-97  L-Bb 
6l9h X-ray 2.6 D 29-97 None
6l9h X-ray 2.6 H 29-97 None
6y5d X-ray 4.1 T 34-101  H-Bb L-Bb 
6y5d X-ray 4.1 D 34-101  H-Bb S-Bb L-Bb 
6y5d X-ray 4.1 H 33-101  H-Bb L-Bb 
6ke9 X-ray 2.22 H 29-97 None
6ke9 X-ray 2.22 D 29-97 None
6t7c X-ray 4 H 27-97  H-Bb S-Bb L-Bb 
6t7c X-ray 4 D 27-97  S-Bb L-Bb 
6t7d X-ray 4.4 H 27-97  L-Bb 
6t7d X-ray 4.4 D 27-97  L-Bb 
6t79 X-ray 3.2 H 27-97  H-Bb L-Bb 
6t79 X-ray 3.2 D 27-97  H-Bb L-Bb 
6t7a X-ray 3.7 D 27-97  L-Bb 
6t7a X-ray 3.7 H 27-97  H-Bb S-Bb L-Bb 
6le9 X-ray 2.6 H 29-97 None
6le9 X-ray 2.6 D 29-97 None
6v92 X-ray 20 h 444-512 None
6v92 X-ray 20 d 6-98  H-Bb H-Mj S-Bb L-Bb 
6y5e X-ray 3.15 D 34-101  H-Bb S-Bb L-Bb 
6y5e X-ray 3.15 H 33-101  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text