Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: O60814
RecName: Histone H2B type 1-K
Begin-End: 36-102
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI
QTAVRLL
Structures of the domain O60814 36-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6y5d X-ray 4.1 P 37-101  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text