Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: O60869
RecName: Endothelial differentiation-related factor 1
Begin-End: 81-133
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR
Structures of the domain O60869 81-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zvh X-ray 2.9 i 81-133 None


© NPIDB team 2003 - 2021

text