Pfam domain
Pfam family: RNase_H (PF00075.26)
Uniprot AC: O60930
RecName: Ribonuclease H1
Begin-End: 138-282
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQA
KTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQ
WMHVPGHSGFIGNEEADRLAREGAK
Structures of the domain O60930 138-282
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2qkk X-ray 3.2 A 137-282 None
2qkk X-ray 3.2 B 138-282 None
2qkk X-ray 3.2 W 138-282 None
2qkk X-ray 3.2 S 138-282 None
2qkk X-ray 3.2 R 138-282 None
2qkk X-ray 3.2 N 138-281 None
2qkk X-ray 3.2 M 138-282 None
2qkk X-ray 3.2 F 137-282 None
2qkk X-ray 3.2 E 138-282 None
2qkk X-ray 3.2 J 138-282 None
2qkk X-ray 3.2 I 138-282 None
2qk9 X-ray 2.55 A 138-282 None
2qkb X-ray 2.4 A 137-282 None
2qkb X-ray 2.4 B 137-282 None


© NPIDB team 2003 - 2021

text