Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: O66430
RecName: 30S ribosomal protein S10
Begin-End: 7-101
Organism: Aquifex aeolicus
Interaction Mode:   

Sequence:
RIKLRAYDHRLLDQSVKQIIETVKRTGGVVKGPIPLPTRKRKWCVLRSPHKFDQSREHFE
IREFSRILDIIRFTPQTIEALMEISLPAGVDVEVK
Structures of the domain O66430 7-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3r2d X-ray 2.2 K 7-50 None
3r2d X-ray 2.2 J 7-50 None
3r2c X-ray 1.9 K 7-50 None
3r2c X-ray 1.9 J 7-50 None


© NPIDB team 2003 - 2021

text