Pfam domain
Pfam family: Sigma54_DBD (PF04552.15)
Uniprot AC: O66858
RecName: RNA polymerase sigma factor RpoN
Begin-End: 338-398
Organism: Aquifex aeolicus
Interaction Mode:   

Sequence:
LTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLGIPSSRERR
I
Structures of the domain O66858 338-398
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o8k NMR A 15-76 None
2o9l NMR A 2-63  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text