Pfam domain
Pfam family: cNMP_binding (PF00027.31)
Uniprot AC: O69245
RecName: FixK2 protein
Begin-End: 42-125
Organism: Bradyrhizobium japonicum
Interaction Mode:   

Sequence:
EFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHLPGDVFGLESGPSHR
LAAEAIIDTSVRLVKRSSLEKAAG
Structures of the domain O69245 42-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4i2o X-ray 1.77 A 42-125 None
4i2o X-ray 1.77 B 42-125 None


© NPIDB team 2003 - 2021

text