Pfam domain
Pfam family: HIT (PF01230.25)
Uniprot AC: O74859
RecName: Aprataxin-like protein
Begin-End: 44-156
Organism: Schizosaccharomyces pombe
Interaction Mode:  S-Bb L-Bb L-Mj 

Sequence:
SPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPLEIMMKHRSLVEKLVSY
VQGDLSGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIMTLDHV
Structures of the domain O74859 44-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3szq X-ray 2.35 A 44-156 None
3spl X-ray 2.1 C 44-156  L-Bb L-Mj 
3spl X-ray 2.1 D 44-156  L-Bb L-Mj 
3spl X-ray 2.1 B 44-156  L-Bb L-Mj 
3spl X-ray 2.1 A 44-156  L-Bb L-Mj 
4ykl X-ray 2.25 B 44-156 None
3spd X-ray 1.91 A 44-156  S-Bb L-Bb L-Mj 
3spd X-ray 1.91 B 44-156  S-Bb L-Bb L-Mj 
3spd X-ray 1.91 C 44-156  S-Bb L-Bb L-Mj 
3spd X-ray 1.91 D 44-156  S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text